PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03943.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 395aa    MW: 44364.8 Da    PI: 7.3621
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03943.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.81.5e-10197255563
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l  l+     l+ e+
  Rsa1.0_03943.1_g00003.1 197 KRAKRIWANRQSAARSKERKTRYIFELERKVQTLQTEATTLSAQLTLLQRDTNGLTVEN 255
                              9********************************************99998887777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.2E-15193257IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.565195258IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-11197251No hitNo description
SuperFamilySSF579592.04E-10197248No hitNo description
PfamPF001707.1E-9197249IPR004827Basic-leucine zipper domain
CDDcd147038.06E-21198247No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MDREKSPAPS GGLPPPSPGP INHGSEANRL NHDMSRMLEH PPKKIGHRRA HSEILTXKPR  60
YEPFDSDLGV VGGGANNAAD GASFSDYTEE DLLSMYLDMD KFNSSTATSS SAGQVGEPSW  120
KNESVMMMHH TGGSSSNPQN SFGERPTRVR HQHSHSMDGS LNMSEMLVSG DGDDSVVDAK  180
KSMSAAKLAE LALIDPKRAK RIWANRQSAA RSKERKTRYI FELERKVQTL QTEATTLSAQ  240
LTLLQRDTNG LTVENNELKL RLQTMEQQVH LQDELNEALK EEIQHLKVLT GQGASSNGAS  300
AMKYGSFGSN QQFYSNNQSM QTILAAQQLQ QLQLHSQKQQ QHQHQQQQQQ QQQQQFQFQQ  360
QQIQQLMHQR LRQQEQQNGT AEVRKQKPFH GQDES
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3532830.0AK353283.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-24-D07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002879324.10.0hypothetical protein ARALYDRAFT_482066
SwissprotQ040880.0POF21_ARATH; Probable transcription factor PosF21
TrEMBLD7LDK30.0D7LDK3_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.4__1126__AT2G31370.40.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31370.51e-138bZIP family protein